PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0173119.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 155aa    MW: 17555.2 Da    PI: 7.3855
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0173119.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.45.8e-5526117293
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                      reqdr lPian+srimkk lPan+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplk+yl++yre+
  Lj0g3v0173119.2  26 REQDRSLPIANISRIMKKGLPANGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKLYLARYREV 117
                      89****************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-5122116IPR009072Histone-fold
SuperFamilySSF471136.06E-3928117IPR009072Histone-fold
PfamPF008084.4E-293195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-215977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-217896No hitNo description
PRINTSPR006151.7E-2197115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MADAPTSPVG GSHESGGEQS PRGSAREQDR SLPIANISRI MKKGLPANGK IAKDAKDTMQ  60
ECVSEFISFI TSEASEKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKLY LARYREVILF  120
WLIHRQYVDI CENLMRQLES PILDPHPRKM TLLKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4624116193NF-YB
4awl_B2e-4624116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4624116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B2e-4626116292Transcription factor HapC (Eurofung)
4g92_B2e-4626116292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.207850.0cell culture| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182829e-79JQ918282.1 Medicago truncatula nuclear transcription factor Y subunit B9 (NF-YB9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002523912.15e-73PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotQ9SLG03e-64NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBLB9SD436e-73B9SD43_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0008s04440.11e-71(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.63e-66nuclear factor Y, subunit B1